Run pipelines, search databases, and get AI-powered analysis from your Python scripts — in a single import.
No cloud accounts. No DevOps. No tool installation. GATK, Boltz, SAMtools, and 50+ tools run securely on our infrastructure so you can stay in your scripts.
from smartsbio import SmartsBio
client = SmartsBio(api_key="sk_live_...")
# Predict 3D structure using Boltz-2 — runs on smarts.bio cloud
pipeline = client.pipelines.run(
workspace_id="ws_...",
pipeline_id="protein-structure-prediction",
parameters={
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRV",
},
)
for update in pipeline.stream():
print(f"[{update.step}] {update.message}")
result = pipeline.wait()
print(f"Structure saved to: {result.outputs['pdb_file']}")Python · Node.js available →
GATK, Boltz, SAMtools, BLAST, and 50+ bioinformatics tools are pre-installed and ready on our cloud. No conda environments, no Docker, no servers to manage.
Every job runs in its own isolated environment on our infrastructure. Your sequences, reads, and results never leave smarts.bio — fully GDPR-compliant.
From a single protein to a genome-wide study — compute scales automatically. No DevOps, no cloud billing surprises, no capacity planning.
Go to Organization Settings → API Keys → Generate key. Your key starts with sk_live_.
Install the Python SDK and start calling the API — no other dependencies needed.
pip install smarts-bioEverything the smarts.bio agent can do — available from your terminal, notebook, or pipeline script.
Trigger multi-step bioinformatics pipelines on our cloud and stream real-time progress back to your script.
Send natural-language questions and get structured, citation-backed bioinformatics answers.
Query PubMed, GenBank, UniProt, STRING-DB, and USPTO programmatically — one API, all databases.
Upload, list, download, and organize FASTQ, BAM, VCF, and other files across your workspaces.
Receive agent output and pipeline logs in real time using async generators — no polling required.
Track compute hours, pipeline status, and API quota from your code or the dashboard.
Every tool, database, and pipeline runs on smarts.bio cloud — nothing to install, nothing to configure.
50+ tools, pre-installed
Query directly, no API keys needed
Multi-step workflows, one API call
Everything you need to integrate and ship.
Any user on a Pro or higher plan can generate API keys from their Organization Settings. Free plan users have a limited monthly API call quota — more than enough to explore and prototype.
No. GATK, Boltz, SAMtools, BLAST, FastQC, Trimmomatic, and 50+ other tools are pre-installed on smarts.bio cloud infrastructure. You just call the API — we handle all the compute.
Official SDKs are available for Python (pip install smarts-bio) and Node.js/TypeScript (npm install @smartsbio/sdk). The underlying REST API works with any language or tool that can make HTTP requests.
Pass your sk_live_... key as the api_key parameter to the SDK constructor, or include it as an Authorization: Bearer <key> header in raw HTTP requests.
Open your workspace in chat.smarts.bio and go to Workspace Settings — the workspace ID appears at the top of the settings panel.
Generate your API key and start running bioinformatics pipelines from Python — in minutes, with zero cloud setup.